PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001478-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 274aa    MW: 30515.9 Da    PI: 5.0829
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001478-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
    NNU_001478-RA 14 KGPWTAEEDKKLINFILTNGHYCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79******************99************************97 PP

2Myb_DNA-binding50.35.4e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l +d++++lG++ W++Ia+ ++ gRt++++k++w+++
    NNU_001478-RA  70 LSEAEEQLVIDLHARLGNR-WSKIASGLP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.88961IPR017930Myb domain
SuperFamilySSF466898.98E-2711108IPR009057Homeodomain-like
SMARTSM007172.0E-121363IPR001005SANT/Myb domain
PfamPF002495.5E-141461IPR001005SANT/Myb domain
CDDcd001678.81E-91661No hitNo description
PROSITE profilePS5129426.45562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2464117IPR009057Homeodomain-like
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002492.8E-1470111IPR001005SANT/Myb domain
CDDcd001676.71E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGHYCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SEAEEQLVID LHARLGNRWS KIASGLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPLH KQAAATTTEL PSSPADHHEL TESNNHGSSS SSEAGGRVIS EDNSSSSTAE  180
NCSGDESRLS DNNWVDGSLM SCLWGDDEPP QEASWNKSPV TGETYNNVDV GLPSWEDNCA  240
WLLDCQDFGV EEFGFGYFDD LAMDMNALEN GEKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010277005.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-101ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B2SEL31e-123A0A0B2SEL3_GLYSO; Protein ODORANT1
TrEMBLA0A0R0LER91e-123A0A0R0LER9_SOYBN; Uncharacterized protein
STRINGGLYMA01G42050.11e-122(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-100myb domain protein 85